Golgappa.net | Golgappa.org | BagIndia.net | BodyIndia.Com | CabIndia.net | CarsBikes.net | CarsBikes.org | CashIndia.net | ConsumerIndia.net | CookingIndia.net | DataIndia.net | DealIndia.net | EmailIndia.net | FirstTablet.com | FirstTourist.com | ForsaleIndia.net | IndiaBody.Com | IndiaCab.net | IndiaCash.net | IndiaModel.net | KidForum.net | OfficeIndia.net | PaysIndia.com | RestaurantIndia.net | RestaurantsIndia.net | SaleForum.net | SellForum.net | SoldIndia.com | StarIndia.net | TomatoCab.com | TomatoCabs.com | TownIndia.com
Interested to Buy Any Domain ? << Click Here >> for more details...


what is FASTA format?

Answers were Sorted based on User's Feedback



what is FASTA format?..

Answer / devanshi

FASTA format is a text-based format for representing either
nucleic acid sequences or protein sequences, in which base
pairs or protein residues are represented using single-
letter codes. The format also allows for sequence names and
comments before the sequences.

The simplicity of FASTA format makes it easy to manipulate
and parse sequences using text-processing tools and
scripting languages like Perl.

Is This Answer Correct ?    7 Yes 0 No

what is FASTA format?..

Answer / bikash ranjan sahoo

It is the representation of nucleic acid or protein
sequences in terms of number of text present in different
number of codes for easy modification,retrieval and
storage.

Is This Answer Correct ?    5 Yes 0 No

what is FASTA format?..

Answer / neeraj verma

FASTA is a DNA and protein sequence alignment software
package first described (as FASTP)
The FASTA file format used as input for this software is now
largely used by other sequence database search tools (such
as BLAST) and sequence alignment programs (Clustal,
T-Coffee, ...)

Is This Answer Correct ?    2 Yes 0 No

what is FASTA format?..

Answer / jyotirindra majumdar

FASTA format is a text-based format for representing either
nucleotide sequences or peptide sequences, in which base
pairs or amino acids are represented using single-letter
codes. A sequence in FASTA format begins with a single-line
description, followed by lines of sequence data. The
description line is distinguished from the sequence data by
a greater-than (">") symbol in the first column. It is
recommended that all lines of text be shorter than 80
characters in length.

An example sequence in FASTA format is:

>gi|186681228|ref|YP_001864424.1|
phycoerythrobilin:ferredoxin oxidoreductase

MNSERSDVTLYQPFLDYAIAYMRSRLDLEPYPIPTGFESNSAVVGKGKNQEEVVTTSYAFQTAKLRQIRA

AHVQGGNSLQVLNFVIFPHLNYDLPFFGADLVTLPGGHLIALDMQPLFRDDSAYQAKYTEPILPIFHAHQ

QHLSWGGDFPEEAQPFFSPAFLWTRPQETAVVETQVFAAFKDYLKAYLDFVEQAEAVTDSQNLVAIKQAQ
LRYLRYRAEKDPARGMFKRFYGAEWTEEYIHGFLFDLERKLTVVK

Is This Answer Correct ?    0 Yes 0 No

Post New Answer

More Bio Informatics Interview Questions

What is the main idea of maximum parsimony in phylogenetic tree construction? What are the drawbacks?

2 Answers  


Did shuffling of protein constituents occur between systems for multicomponent transport systems such as the atp-binding-cassette or complex protein secretion systems?

0 Answers  


Can DeCypher be used for protein struc-ture modeling?

0 Answers  


Define toxicogenomics?

1 Answers  


What is the input and outpit of a distance based algorithm?

0 Answers   Biocon,


What is the difference in terms of connectivity between a scale free network and random network?

0 Answers  


How the Algorithm works?

0 Answers  


Did bacteria, archaea, and eukaryotes exchange transporter genes appreciably during the past two billion years?

0 Answers  


A man speaks the truth 3 out of 4 times. He throws a die and reports it to be a 6. What is the probability of it being a 6? (a) 3/8 (b) 5/8 (c) 3/4 (d) None of the above

11 Answers   HDFC, Microsoft, MNC, TCS, Wipro,


what is the use of Morphometrics?

1 Answers  


How did you get into the field of bioinformatics?

0 Answers  


what is the difference between present and oldest drug discovery methods?

1 Answers   Thomson Reuters,


Categories