Interested to Buy Any Domain ? << Click Here >> for more details...
what is FASTA format?
- 4 Answers
- 10316 Views
- I also Faced
- E-Mail Answers
Answers were Sorted based on User's Feedback
Answer / devanshi
FASTA format is a text-based format for representing either
nucleic acid sequences or protein sequences, in which base
pairs or protein residues are represented using single-
letter codes. The format also allows for sequence names and
comments before the sequences.
The simplicity of FASTA format makes it easy to manipulate
and parse sequences using text-processing tools and
scripting languages like Perl.
| Is This Answer Correct ? | 7 Yes | 0 No |
Answer / bikash ranjan sahoo
It is the representation of nucleic acid or protein
sequences in terms of number of text present in different
number of codes for easy modification,retrieval and
storage.
| Is This Answer Correct ? | 5 Yes | 0 No |
Answer / neeraj verma
FASTA is a DNA and protein sequence alignment software
package first described (as FASTP)
The FASTA file format used as input for this software is now
largely used by other sequence database search tools (such
as BLAST) and sequence alignment programs (Clustal,
T-Coffee, ...)
| Is This Answer Correct ? | 2 Yes | 0 No |
Answer / jyotirindra majumdar
FASTA format is a text-based format for representing either
nucleotide sequences or peptide sequences, in which base
pairs or amino acids are represented using single-letter
codes. A sequence in FASTA format begins with a single-line
description, followed by lines of sequence data. The
description line is distinguished from the sequence data by
a greater-than (">") symbol in the first column. It is
recommended that all lines of text be shorter than 80
characters in length.
An example sequence in FASTA format is:
>gi|186681228|ref|YP_001864424.1|
phycoerythrobilin:ferredoxin oxidoreductase
MNSERSDVTLYQPFLDYAIAYMRSRLDLEPYPIPTGFESNSAVVGKGKNQEEVVTTSYAFQTAKLRQIRA
AHVQGGNSLQVLNFVIFPHLNYDLPFFGADLVTLPGGHLIALDMQPLFRDDSAYQAKYTEPILPIFHAHQ
QHLSWGGDFPEEAQPFFSPAFLWTRPQETAVVETQVFAAFKDYLKAYLDFVEQAEAVTDSQNLVAIKQAQ
LRYLRYRAEKDPARGMFKRFYGAEWTEEYIHGFLFDLERKLTVVK
| Is This Answer Correct ? | 0 Yes | 0 No |
How to find coexpressed genes on NCBI GEO?
Can DeCypher be used for protein struc-ture modeling?
How is the position of a nucleotide substitution on genome detected? I mean that it is on exon, intron or promoter region?
What is the product of the irrational roots of the equation (2x-1)(2x-3)(2x-5)(2x-7)=9?
What is Far Western Screening ?
If the sum of n terms of two series of A.P are in the ratio 5n+4:9n+6 .find the ratio of their 13th terms?
When X-Ray photons collide with electrons (a) They slow down (b) Their mass increases (c) Their wave length increases (d) Their energy decreases.
what is Genome annotation?
How will you value a biotech company as opposed to a consumer products company?
what is the Reaction intermediate in Reimer-Tiemann?s reaction?
What is an alignment?
How many grams of NaOH will react with 0.2 equivalent of HCl? (a) 0.59 (b) 0.285 (c) 1.18 (d) none of these.
Micro Biology 
