what is FASTA format?

Answers were Sorted based on User's Feedback



what is FASTA format?..

Answer / devanshi

FASTA format is a text-based format for representing either
nucleic acid sequences or protein sequences, in which base
pairs or protein residues are represented using single-
letter codes. The format also allows for sequence names and
comments before the sequences.

The simplicity of FASTA format makes it easy to manipulate
and parse sequences using text-processing tools and
scripting languages like Perl.

Is This Answer Correct ?    7 Yes 0 No

what is FASTA format?..

Answer / bikash ranjan sahoo

It is the representation of nucleic acid or protein
sequences in terms of number of text present in different
number of codes for easy modification,retrieval and
storage.

Is This Answer Correct ?    5 Yes 0 No

what is FASTA format?..

Answer / neeraj verma

FASTA is a DNA and protein sequence alignment software
package first described (as FASTP)
The FASTA file format used as input for this software is now
largely used by other sequence database search tools (such
as BLAST) and sequence alignment programs (Clustal,
T-Coffee, ...)

Is This Answer Correct ?    2 Yes 0 No

what is FASTA format?..

Answer / jyotirindra majumdar

FASTA format is a text-based format for representing either
nucleotide sequences or peptide sequences, in which base
pairs or amino acids are represented using single-letter
codes. A sequence in FASTA format begins with a single-line
description, followed by lines of sequence data. The
description line is distinguished from the sequence data by
a greater-than (">") symbol in the first column. It is
recommended that all lines of text be shorter than 80
characters in length.

An example sequence in FASTA format is:

>gi|186681228|ref|YP_001864424.1|
phycoerythrobilin:ferredoxin oxidoreductase

MNSERSDVTLYQPFLDYAIAYMRSRLDLEPYPIPTGFESNSAVVGKGKNQEEVVTTSYAFQTAKLRQIRA

AHVQGGNSLQVLNFVIFPHLNYDLPFFGADLVTLPGGHLIALDMQPLFRDDSAYQAKYTEPILPIFHAHQ

QHLSWGGDFPEEAQPFFSPAFLWTRPQETAVVETQVFAAFKDYLKAYLDFVEQAEAVTDSQNLVAIKQAQ
LRYLRYRAEKDPARGMFKRFYGAEWTEEYIHGFLFDLERKLTVVK

Is This Answer Correct ?    0 Yes 0 No

Post New Answer

More Bio Informatics Interview Questions

What is Phantom Gene Sequence?

1 Answers  


If the sum of n terms of two series of A.P are in the ratio 5n+4:9n+6 .find the ratio of their 13th terms

3 Answers   Deloitte, IIT, Wipro,


What is computational biology?

1 Answers  


The mass number of a nucleus is (a) Always less than its atomic number (b) Always more than its atomic number (c) Sometimes more than and sometimes equal to its atomic number (d) None of the above

2 Answers   Wipro,


Does multidrug resistance (mdr) arise by activation of stable genes encoding drug efflux pumps or by mutations of genes encoding other types of transporters in bacterial pathogens?

1 Answers  


What is the product of the irrational roots of the equation (2x-1)(2x-3)(2x-5)(2x-7)=9?

1 Answers  


Explain Homology modelling?

1 Answers  


Exactly how fast is PatternHunter when comparing two DNA sequences?

1 Answers  


what is the image of point (3,8) in the line x + 3y = 7 ?

1 Answers  


How do you customize database for blast?

1 Answers  


What is Medical Informatics?

1 Answers  


If a match from a sequence database search is reported to have an E-value of 0.0, should it be considered highly insignificant or highly significant?

3 Answers  


Categories