Follow Our FB Page << CircleMedia.in >> for Daily Laughter. We Post Funny, Viral, Comedy Videos, Memes, Vines...


what is FASTA format?

Answers were Sorted based on User's Feedback



what is FASTA format?..

Answer / devanshi

FASTA format is a text-based format for representing either
nucleic acid sequences or protein sequences, in which base
pairs or protein residues are represented using single-
letter codes. The format also allows for sequence names and
comments before the sequences.

The simplicity of FASTA format makes it easy to manipulate
and parse sequences using text-processing tools and
scripting languages like Perl.

Is This Answer Correct ?    7 Yes 0 No

what is FASTA format?..

Answer / bikash ranjan sahoo

It is the representation of nucleic acid or protein
sequences in terms of number of text present in different
number of codes for easy modification,retrieval and
storage.

Is This Answer Correct ?    5 Yes 0 No

what is FASTA format?..

Answer / neeraj verma

FASTA is a DNA and protein sequence alignment software
package first described (as FASTP)
The FASTA file format used as input for this software is now
largely used by other sequence database search tools (such
as BLAST) and sequence alignment programs (Clustal,
T-Coffee, ...)

Is This Answer Correct ?    2 Yes 0 No

what is FASTA format?..

Answer / jyotirindra majumdar

FASTA format is a text-based format for representing either
nucleotide sequences or peptide sequences, in which base
pairs or amino acids are represented using single-letter
codes. A sequence in FASTA format begins with a single-line
description, followed by lines of sequence data. The
description line is distinguished from the sequence data by
a greater-than (">") symbol in the first column. It is
recommended that all lines of text be shorter than 80
characters in length.

An example sequence in FASTA format is:

>gi|186681228|ref|YP_001864424.1|
phycoerythrobilin:ferredoxin oxidoreductase

MNSERSDVTLYQPFLDYAIAYMRSRLDLEPYPIPTGFESNSAVVGKGKNQEEVVTTSYAFQTAKLRQIRA

AHVQGGNSLQVLNFVIFPHLNYDLPFFGADLVTLPGGHLIALDMQPLFRDDSAYQAKYTEPILPIFHAHQ

QHLSWGGDFPEEAQPFFSPAFLWTRPQETAVVETQVFAAFKDYLKAYLDFVEQAEAVTDSQNLVAIKQAQ
LRYLRYRAEKDPARGMFKRFYGAEWTEEYIHGFLFDLERKLTVVK

Is This Answer Correct ?    0 Yes 0 No

Post New Answer

More Bio Informatics Interview Questions

what is e value?

4 Answers  


What is PatternHunter?

1 Answers  


What are the current challenges in the Pharmaceutical and biotechnology sectors?

0 Answers  


Will the plant able to produce electricity when the soil is dried up

0 Answers  


which instrument is most commonly used to observe the external features of grasshopper's abdomen?

1 Answers  






Have the proteins of a family generally acquired distinctive properties within each of these three kingdoms for ancient families that arose before bacteria, archaea and eukaryotes diverged?

0 Answers  


When a bicycle is in motion, the force of friction exerted by the ground on the two wheels is such that it acts a) In the backward direction on the front wheel and in the forward direction on the rear wheel. (b) In the forward direction on the front wheel and in the backward direction on the rear wheel. (c) In the backward direction on both the front and rear wheels. (d) In the backward direction on both the front and rear wheels.

8 Answers   College School Exams Tests, IIM, IIT, JGK, Wipro,


If the sum of n terms of two series of A.P are in the ratio 5n+4:9n+6 .find the ratio of their 13th terms?

1 Answers   TCS, Wipro,


What is the main idea of maximum parsimony in phylogenetic tree construction? What are the drawbacks?

2 Answers  


How to identify highly mutated aminoacid from clustalw?

3 Answers  


what is the length of the exon and intron

3 Answers  


How to assign alpha helix & beta sheets?

1 Answers   Wipro,


Categories