what is FASTA format?
Answers were Sorted based on User's Feedback
Answer / devanshi
FASTA format is a text-based format for representing either
nucleic acid sequences or protein sequences, in which base
pairs or protein residues are represented using single-
letter codes. The format also allows for sequence names and
comments before the sequences.
The simplicity of FASTA format makes it easy to manipulate
and parse sequences using text-processing tools and
scripting languages like Perl.
| Is This Answer Correct ? | 7 Yes | 0 No |
Answer / bikash ranjan sahoo
It is the representation of nucleic acid or protein
sequences in terms of number of text present in different
number of codes for easy modification,retrieval and
storage.
| Is This Answer Correct ? | 5 Yes | 0 No |
Answer / neeraj verma
FASTA is a DNA and protein sequence alignment software
package first described (as FASTP)
The FASTA file format used as input for this software is now
largely used by other sequence database search tools (such
as BLAST) and sequence alignment programs (Clustal,
T-Coffee, ...)
| Is This Answer Correct ? | 2 Yes | 0 No |
Answer / jyotirindra majumdar
FASTA format is a text-based format for representing either
nucleotide sequences or peptide sequences, in which base
pairs or amino acids are represented using single-letter
codes. A sequence in FASTA format begins with a single-line
description, followed by lines of sequence data. The
description line is distinguished from the sequence data by
a greater-than (">") symbol in the first column. It is
recommended that all lines of text be shorter than 80
characters in length.
An example sequence in FASTA format is:
>gi|186681228|ref|YP_001864424.1|
phycoerythrobilin:ferredoxin oxidoreductase
MNSERSDVTLYQPFLDYAIAYMRSRLDLEPYPIPTGFESNSAVVGKGKNQEEVVTTSYAFQTAKLRQIRA
AHVQGGNSLQVLNFVIFPHLNYDLPFFGADLVTLPGGHLIALDMQPLFRDDSAYQAKYTEPILPIFHAHQ
QHLSWGGDFPEEAQPFFSPAFLWTRPQETAVVETQVFAAFKDYLKAYLDFVEQAEAVTDSQNLVAIKQAQ
LRYLRYRAEKDPARGMFKRFYGAEWTEEYIHGFLFDLERKLTVVK
| Is This Answer Correct ? | 0 Yes | 0 No |
Did bacteria, archaea, and eukaryotes exchange transporter genes appreciably during the past two billion years?
What is the product of the irrational roots of the equation (2x-1)(2x-3)(2x-5)(2x-7)=9?
Which of the following is least acidic (a) Ortho-cresol (b) Para-cresol (c) Phenol (d) Meta-cresol.
If Young?s double slit experiment is performed in water (a) the fringe width will decrease (b) the fringe width will increase (c) the fringe width remains unchanged (d) there will be no fringe.
What is a ?clean and run? reaction?
How is the respiratory system applied to the sport paintball?
What is Phantom Gene Sequence?
Have the proteins of a family generally acquired distinctive properties within each of these three kingdoms for ancient families that arose before bacteria, archaea and eukaryotes diverged?
What is Far Western Screening ?
what is a Homologue?
If cos2A + cos2B + cos2C = 1 then ABC is which type of triangle?
In the next two or three years what will the important advances in the field be?