Golgappa.net | Golgappa.org | BagIndia.net | BodyIndia.Com | CabIndia.net | CarsBikes.net | CarsBikes.org | CashIndia.net | ConsumerIndia.net | CookingIndia.net | DataIndia.net | DealIndia.net | EmailIndia.net | FirstTablet.com | FirstTourist.com | ForsaleIndia.net | IndiaBody.Com | IndiaCab.net | IndiaCash.net | IndiaModel.net | KidForum.net | OfficeIndia.net | PaysIndia.com | RestaurantIndia.net | RestaurantsIndia.net | SaleForum.net | SellForum.net | SoldIndia.com | StarIndia.net | TomatoCab.com | TomatoCabs.com | TownIndia.com
Interested to Buy Any Domain ? << Click Here >> for more details...


what is FASTA format?

Answers were Sorted based on User's Feedback



what is FASTA format?..

Answer / devanshi

FASTA format is a text-based format for representing either
nucleic acid sequences or protein sequences, in which base
pairs or protein residues are represented using single-
letter codes. The format also allows for sequence names and
comments before the sequences.

The simplicity of FASTA format makes it easy to manipulate
and parse sequences using text-processing tools and
scripting languages like Perl.

Is This Answer Correct ?    7 Yes 0 No

what is FASTA format?..

Answer / bikash ranjan sahoo

It is the representation of nucleic acid or protein
sequences in terms of number of text present in different
number of codes for easy modification,retrieval and
storage.

Is This Answer Correct ?    5 Yes 0 No

what is FASTA format?..

Answer / neeraj verma

FASTA is a DNA and protein sequence alignment software
package first described (as FASTP)
The FASTA file format used as input for this software is now
largely used by other sequence database search tools (such
as BLAST) and sequence alignment programs (Clustal,
T-Coffee, ...)

Is This Answer Correct ?    2 Yes 0 No

what is FASTA format?..

Answer / jyotirindra majumdar

FASTA format is a text-based format for representing either
nucleotide sequences or peptide sequences, in which base
pairs or amino acids are represented using single-letter
codes. A sequence in FASTA format begins with a single-line
description, followed by lines of sequence data. The
description line is distinguished from the sequence data by
a greater-than (">") symbol in the first column. It is
recommended that all lines of text be shorter than 80
characters in length.

An example sequence in FASTA format is:

>gi|186681228|ref|YP_001864424.1|
phycoerythrobilin:ferredoxin oxidoreductase

MNSERSDVTLYQPFLDYAIAYMRSRLDLEPYPIPTGFESNSAVVGKGKNQEEVVTTSYAFQTAKLRQIRA

AHVQGGNSLQVLNFVIFPHLNYDLPFFGADLVTLPGGHLIALDMQPLFRDDSAYQAKYTEPILPIFHAHQ

QHLSWGGDFPEEAQPFFSPAFLWTRPQETAVVETQVFAAFKDYLKAYLDFVEQAEAVTDSQNLVAIKQAQ
LRYLRYRAEKDPARGMFKRFYGAEWTEEYIHGFLFDLERKLTVVK

Is This Answer Correct ?    0 Yes 0 No

Post New Answer

More Bio Informatics Interview Questions

Some forms are books. All books are made of paper (a) Some forms are made of paper (b) Some forms are not made of paper (c) No forms are made of paper (d) None of the above.

1 Answers   Wipro,


How to compare two DNA sequences?

1 Answers  


What is an ontology?

1 Answers   Wipro,


NLO : RPS : : ? : ZXA

0 Answers   Wipro,


Suppose you used the NCBI Blast server to look for a match to a fruit-fly gene. Suppose further that the best alignment contained this section of an alignment: Hit from database: XXXXXXXXXXXXXXNFSTSQ user sequence: SLEAEAAPASISPSNFSSSQ What do the Xs signify?

4 Answers   Infosys,


A radioactive element x has an atomic number of 100. It decays directly into an element y which decays directly into element z. In both processes a charged particle is emitted. Which of the following statements would be true? (a) y has an atomic number of 102 (b) y has an atomic number of 101 (c) z has an atomic number of 100 (d) z has an atomic number of 101

1 Answers   Wipro,


what is the principle involved in Biometry?

0 Answers  


A certain radioactive element A, has a half life = t seconds. In (t/2) seconds the fraction of the initial quantity of the element so far decayed is nearly how much?

0 Answers  


Which of the following parameters is the same for molecules of all gases at a given temperature? (a) Mass (b) Momentum (c) Speed (d) Kinetic energy.

1 Answers   IBM, SIR, Wipro,


How do you customize database for blast?

0 Answers  


What is the secondary structure of intron ?

0 Answers  


which field have wider prospective of job... M.sc bioinformatics or M.sc biotechnology

5 Answers  


Categories