what is FASTA format?
- 4 Answers
- 8203 Views
- I also Faced
- E-Mail Answers
Answers were Sorted based on User's Feedback
Answer / devanshi
FASTA format is a text-based format for representing either
nucleic acid sequences or protein sequences, in which base
pairs or protein residues are represented using single-
letter codes. The format also allows for sequence names and
comments before the sequences.
The simplicity of FASTA format makes it easy to manipulate
and parse sequences using text-processing tools and
scripting languages like Perl.
| Is This Answer Correct ? | 7 Yes | 0 No |
Answer / bikash ranjan sahoo
It is the representation of nucleic acid or protein
sequences in terms of number of text present in different
number of codes for easy modification,retrieval and
storage.
| Is This Answer Correct ? | 5 Yes | 0 No |
Answer / neeraj verma
FASTA is a DNA and protein sequence alignment software
package first described (as FASTP)
The FASTA file format used as input for this software is now
largely used by other sequence database search tools (such
as BLAST) and sequence alignment programs (Clustal,
T-Coffee, ...)
| Is This Answer Correct ? | 2 Yes | 0 No |
Answer / jyotirindra majumdar
FASTA format is a text-based format for representing either
nucleotide sequences or peptide sequences, in which base
pairs or amino acids are represented using single-letter
codes. A sequence in FASTA format begins with a single-line
description, followed by lines of sequence data. The
description line is distinguished from the sequence data by
a greater-than (">") symbol in the first column. It is
recommended that all lines of text be shorter than 80
characters in length.
An example sequence in FASTA format is:
>gi|186681228|ref|YP_001864424.1|
phycoerythrobilin:ferredoxin oxidoreductase
MNSERSDVTLYQPFLDYAIAYMRSRLDLEPYPIPTGFESNSAVVGKGKNQEEVVTTSYAFQTAKLRQIRA
AHVQGGNSLQVLNFVIFPHLNYDLPFFGADLVTLPGGHLIALDMQPLFRDDSAYQAKYTEPILPIFHAHQ
QHLSWGGDFPEEAQPFFSPAFLWTRPQETAVVETQVFAAFKDYLKAYLDFVEQAEAVTDSQNLVAIKQAQ
LRYLRYRAEKDPARGMFKRFYGAEWTEEYIHGFLFDLERKLTVVK
| Is This Answer Correct ? | 0 Yes | 0 No |
The maximum KE of the photoelectron emitted from a surface is dependent on (a) The intensity of incident radiation (b) The potential of the collector electrode (c) The frequency of incident radiation (d) The angle of incidence of radiation of the surface
What is computational biology?
How do ESTs work?
Explain about needleman-wunsch algorithm?
An electron emits energy (a) Because its in orbit (b) When it jumps from one energy level to another (c) Electrons are attracted towards the nucleus (d) The electrostatic force is insufficient to hold the electrons in orbits.
Integrate 3x + 5 / (x3-x2-x+1)?
If cos2A + cos2B + cos2C = 1 then ABC is which type of triangle?
Draw the E-R diagram for the database of a departmental store having the following relational database scheme Employees(e-no, address) Department(d-name) work-n(e-no, d-name) Looking-after(d-name, e-no) Item (item-no, brand-name, model-no, cost-price, sale-price)
What is Phantom Gene Sequence?
How is the respiratory system applied to the sport paintball?
what is QSAR (quantitative structure-activity relationship?
How you caluculate sensitivity and selectivity of Blast?
Micro Biology 
