Interested to Buy Any Domain ? << Click Here >> for more details...
Answer Posted / jyotirindra majumdar
FASTA format is a text-based format for representing either
nucleotide sequences or peptide sequences, in which base
pairs or amino acids are represented using single-letter
codes. A sequence in FASTA format begins with a single-line
description, followed by lines of sequence data. The
description line is distinguished from the sequence data by
a greater-than (">") symbol in the first column. It is
recommended that all lines of text be shorter than 80
characters in length.
An example sequence in FASTA format is:
>gi|186681228|ref|YP_001864424.1|
phycoerythrobilin:ferredoxin oxidoreductase
MNSERSDVTLYQPFLDYAIAYMRSRLDLEPYPIPTGFESNSAVVGKGKNQEEVVTTSYAFQTAKLRQIRA
AHVQGGNSLQVLNFVIFPHLNYDLPFFGADLVTLPGGHLIALDMQPLFRDDSAYQAKYTEPILPIFHAHQ
QHLSWGGDFPEEAQPFFSPAFLWTRPQETAVVETQVFAAFKDYLKAYLDFVEQAEAVTDSQNLVAIKQAQ
LRYLRYRAEKDPARGMFKRFYGAEWTEEYIHGFLFDLERKLTVVK
| Is This Answer Correct ? | 0 Yes | 0 No |
Post New Answer View All Answers
A certain radioactive element A, has a half life = t seconds. In (t/2) seconds the fraction of the initial quantity of the element so far decayed is nearly how much?
can u give me an example of a project you were involved with that illustrates your interest and skills in bringing people together?
How a cluster algorithm works?
How do ESTs work?
What is the difference in terms of connectivity between a scale free network and random network?
What are oesophageal molecular markers?
How to caculate coordinates of each atoms on 3 D HP model?
What is the input and outpit of a distance based algorithm?
How to Count number of nucleotide substitutions ?
what is the image of point (3,8) in the line x + 3y = 7 ?
How will you value a biotech company as opposed to a consumer products company?
Does multidrug resistance (mdr) arise by activation of stable genes encoding drug efflux pumps or by mutations of genes encoding other types of transporters in bacterial pathogens?
Are all members of transporter families confined to a particular organelle or to the plasma membrane, or are some family members found throughout cellular compartments in eukaryotes?
What is protein sequencing?
How did you get into the field of bioinformatics?
