Interested to Buy Any Domain ? << Click Here >> for more details...
Answer Posted / jyotirindra majumdar
FASTA format is a text-based format for representing either
nucleotide sequences or peptide sequences, in which base
pairs or amino acids are represented using single-letter
codes. A sequence in FASTA format begins with a single-line
description, followed by lines of sequence data. The
description line is distinguished from the sequence data by
a greater-than (">") symbol in the first column. It is
recommended that all lines of text be shorter than 80
characters in length.
An example sequence in FASTA format is:
>gi|186681228|ref|YP_001864424.1|
phycoerythrobilin:ferredoxin oxidoreductase
MNSERSDVTLYQPFLDYAIAYMRSRLDLEPYPIPTGFESNSAVVGKGKNQEEVVTTSYAFQTAKLRQIRA
AHVQGGNSLQVLNFVIFPHLNYDLPFFGADLVTLPGGHLIALDMQPLFRDDSAYQAKYTEPILPIFHAHQ
QHLSWGGDFPEEAQPFFSPAFLWTRPQETAVVETQVFAAFKDYLKAYLDFVEQAEAVTDSQNLVAIKQAQ
LRYLRYRAEKDPARGMFKRFYGAEWTEEYIHGFLFDLERKLTVVK
| Is This Answer Correct ? | 0 Yes | 0 No |
Post New Answer View All Answers
Is there is best online Training for Bioinformatics
What is the secondary structure of intron ?
How do ESTs work?
Define perl and clustalW problem?
Draw the E-R diagram for the database of a departmental store having the following relational database scheme Employees(e-no, address) Department(d-name) work-n(e-no, d-name) Looking-after(d-name, e-no) Item (item-no, brand-name, model-no, cost-price, sale-price)
what is the image of point (3,8) in the line x + 3y = 7 ?
what is an active ? (UML)
How to Insert Genomic DNA into yeast ?
Have the proteins of a family generally acquired distinctive properties within each of these three kingdoms for ancient families that arose before bacteria, archaea and eukaryotes diverged?
NLO : RPS : : ? : ZXA
What is the criteria for LTQ (LC-MS/MS) SEQUEST search?
Does multidrug resistance (mdr) arise by activation of stable genes encoding drug efflux pumps or by mutations of genes encoding other types of transporters in bacterial pathogens?
What are the bioinformatic tools applied to micromolecular evolution?
What is a DNA array?
What is computational biology?
