Answer Posted / jyotirindra majumdar
FASTA format is a text-based format for representing either
nucleotide sequences or peptide sequences, in which base
pairs or amino acids are represented using single-letter
codes. A sequence in FASTA format begins with a single-line
description, followed by lines of sequence data. The
description line is distinguished from the sequence data by
a greater-than (">") symbol in the first column. It is
recommended that all lines of text be shorter than 80
characters in length.
An example sequence in FASTA format is:
>gi|186681228|ref|YP_001864424.1|
phycoerythrobilin:ferredoxin oxidoreductase
MNSERSDVTLYQPFLDYAIAYMRSRLDLEPYPIPTGFESNSAVVGKGKNQEEVVTTSYAFQTAKLRQIRA
AHVQGGNSLQVLNFVIFPHLNYDLPFFGADLVTLPGGHLIALDMQPLFRDDSAYQAKYTEPILPIFHAHQ
QHLSWGGDFPEEAQPFFSPAFLWTRPQETAVVETQVFAAFKDYLKAYLDFVEQAEAVTDSQNLVAIKQAQ
LRYLRYRAEKDPARGMFKRFYGAEWTEEYIHGFLFDLERKLTVVK
| Is This Answer Correct ? | 0 Yes | 0 No |
Post New Answer View All Answers
How to find a sequence of dna molecule?
What are the current challenges in the Pharmaceutical and biotechnology sectors?
What are oesophageal molecular markers?
What is the input and outpit of a distance based algorithm?
Did integral membrane transport proteins arise as an independent protein class or from other types of proteins?
Explain about needleman-wunsch algorithm?
Can DeCypher be used for protein struc-ture modeling?
Describe the aim of microarray data analysis?
How a cluster algorithm works?
Did shuffling of protein constituents occur between systems for multicomponent transport systems such as the atp-binding-cassette or complex protein secretion systems?
can u give me an example of a project you were involved with that illustrates your interest and skills in bringing people together?
How did you get into the field of bioinformatics?
What is Phantom Gene Sequence?
NLO : RPS : : ? : ZXA
How to caculate coordinates of each atoms on 3 D HP model?
