what is FASTA format?
- 4 Answers
- 8209 Views
- I also Faced
- E-Mail Answers
Answers were Sorted based on User's Feedback
Answer / devanshi
FASTA format is a text-based format for representing either
nucleic acid sequences or protein sequences, in which base
pairs or protein residues are represented using single-
letter codes. The format also allows for sequence names and
comments before the sequences.
The simplicity of FASTA format makes it easy to manipulate
and parse sequences using text-processing tools and
scripting languages like Perl.
| Is This Answer Correct ? | 7 Yes | 0 No |
Answer / bikash ranjan sahoo
It is the representation of nucleic acid or protein
sequences in terms of number of text present in different
number of codes for easy modification,retrieval and
storage.
| Is This Answer Correct ? | 5 Yes | 0 No |
Answer / neeraj verma
FASTA is a DNA and protein sequence alignment software
package first described (as FASTP)
The FASTA file format used as input for this software is now
largely used by other sequence database search tools (such
as BLAST) and sequence alignment programs (Clustal,
T-Coffee, ...)
| Is This Answer Correct ? | 2 Yes | 0 No |
Answer / jyotirindra majumdar
FASTA format is a text-based format for representing either
nucleotide sequences or peptide sequences, in which base
pairs or amino acids are represented using single-letter
codes. A sequence in FASTA format begins with a single-line
description, followed by lines of sequence data. The
description line is distinguished from the sequence data by
a greater-than (">") symbol in the first column. It is
recommended that all lines of text be shorter than 80
characters in length.
An example sequence in FASTA format is:
>gi|186681228|ref|YP_001864424.1|
phycoerythrobilin:ferredoxin oxidoreductase
MNSERSDVTLYQPFLDYAIAYMRSRLDLEPYPIPTGFESNSAVVGKGKNQEEVVTTSYAFQTAKLRQIRA
AHVQGGNSLQVLNFVIFPHLNYDLPFFGADLVTLPGGHLIALDMQPLFRDDSAYQAKYTEPILPIFHAHQ
QHLSWGGDFPEEAQPFFSPAFLWTRPQETAVVETQVFAAFKDYLKAYLDFVEQAEAVTDSQNLVAIKQAQ
LRYLRYRAEKDPARGMFKRFYGAEWTEEYIHGFLFDLERKLTVVK
| Is This Answer Correct ? | 0 Yes | 0 No |
The rate of the first order reaction depends on the (a) Concentration of the reactant (b) Concentration of the product (c) Time (d) Temperature.
What is the Equation for cell diffusion?
Does multidrug resistance (mdr) arise by activation of stable genes encoding drug efflux pumps or by mutations of genes encoding other types of transporters in bacterial pathogens?
A man speaks the truth 3 out of 4 times. He throws a die and reports it to be a 6. What is the probability of it being a 6? (a) 3/8 (b) 5/8 (c) 3/4 (d) None of the above
11 Answers HDFC, Microsoft, MNC, TCS, Wipro,
Integrate 3x + 5 / (x3-x2-x+1)?
What are oesophageal molecular markers?
Will the plant able to produce electricity when the soil is dried up
what are databases used in bioinformatics?
Did bacteria, archaea, and eukaryotes exchange transporter genes appreciably during the past two billion years?
Can DeCypher be used for protein struc-ture modeling?
which field have wider prospective of job... M.sc bioinformatics or M.sc biotechnology
Why was the PatternHunter software program developed?
Micro Biology 
